PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009613291.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 633aa    MW: 71171.3 Da    PI: 4.6635
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009613291.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.25.4e-52231492128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     ppGfrFhPtdeelv +yLkkk+ +k++ l ++i+e+d+yk++P+dLp  +k+k+++++w+fFs+rd+ky++g r+nratk+gyWkatgkd+ +++
  XP_009613291.1  23 PPGFRFHPTDEELVLYYLKKKICRKRILL-DAIAETDVYKWDPEDLPdlSKLKTGDRQWFFFSPRDRKYPNGARSNRATKHGYWKATGKDRIITC 116
                     9*************************999.99**************96559999***************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kktLvfykgrap ge+tdWvmhey++
  XP_009613291.1 117 -NSRAVGVKKTLVFYKGRAPVGERTDWVMHEYTM 149
                     .999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5919172IPR003441NAC domain
PROSITE profilePS5100555.55222172IPR003441NAC domain
PfamPF023651.8E-2723148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MKMLELTDSD SFACFGSSKN VFPPGFRFHP TDEELVLYYL KKKICRKRIL LDAIAETDVY  60
KWDPEDLPDL SKLKTGDRQW FFFSPRDRKY PNGARSNRAT KHGYWKATGK DRIITCNSRA  120
VGVKKTLVFY KGRAPVGERT DWVMHEYTMD EEELKRCQNV HDYYALYKVF KKSGPGPKNN  180
EQYGAPFREE DWVDDECPST KASVRLVDDE RPSAKASVRL VDDERPSAKA SVRQDTSAKH  240
VNEAPSVDGG LEEFLNNIAA DAVLVEPLCV DYDYALEQLV LEEDTESTLL DHSSGEINFP  300
NHSAVISPSC QQYHAKESFD LTQSGTSQLQ LHEAPEVTSA PVSREQQCHV VEEDFLEDYL  360
EMNDLLGPEP SIQNFDNPEL GVKNFDEAGP SGQNFDKPAG NFEDLQFDYL DGLTEFDLYH  420
DAPLLLDDIR TTDVGQITEP YMNNFVNGAV NPVSTTYLST FQNEMVNHQP MYLNNGEQIS  480
NQLWTHDQRF NIYNPIEANQ LVVPPATSGV VYDSNLANHH MGANQNQIVR QDNGTPSWFS  540
SQLWAFVDSI PTTPAAAAES PLVNGAFKRM SSFSKLRINA RNMNVVAGNT VTSSSLGNSK  600
NGVFYFSFLG ILCAILCVLV GTYVKVLGRY ISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-482214915140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613291.10.0PREDICTED: uncharacterized protein LOC104106448 isoform X1
TrEMBLM1BF210.0M1BF21_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000436810.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32122451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-126NAC domain containing protein 17